SCOP 1.55: Domain d1sftb2: 1sft B:12-244

Lineage for d1sftb2 (1sft B:12-244)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (2 proteins)

6. Protein Alanine racemase [51421] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51422] (3 PDB entries)

8. Domain d1sftb2: 1sft B:12-244 [28645]
   Other proteins in same PDB: d1sfta1, d1sftb1

Details for d1sftb2

PDB Entry: 1sft, 1.9 Å

PDB Description: alanine racemase

SCOP Domain Sequences for d1sftb2:

Sequence; same for both SEQRES and ATOM records:

>d1sftb2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

Timeline for d1sftb2:

• d1sftb2 appears in SCOP 1.57
  
• d1sftb2 appears in the current release, SCOPe 2.08