Lineage for d1bd0b2 (1bd0 B:12-244)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969456Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 969457Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins)
  6. 969458Protein Alanine racemase [51421] (3 species)
  7. 969459Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries)
  8. 969461Domain d1bd0b2: 1bd0 B:12-244 [28643]
    Other proteins in same PDB: d1bd0a1, d1bd0b1
    complexed with in5

Details for d1bd0b2

PDB Entry: 1bd0 (more details), 1.6 Å

PDB Description: alanine racemase complexed with alanine phosphonate
PDB Compounds: (B:) alanine racemase

SCOPe Domain Sequences for d1bd0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd0b2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

SCOPe Domain Coordinates for d1bd0b2:

Click to download the PDB-style file with coordinates for d1bd0b2.
(The format of our PDB-style files is described here.)

Timeline for d1bd0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bd0b1