Lineage for d1bd0a2 (1bd0 A:12-244)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18625Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
  5. 18626Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (2 proteins)
  6. 18627Protein Alanine racemase [51421] (1 species)
  7. 18628Species Bacillus stearothermophilus [TaxId:1422] [51422] (3 PDB entries)
  8. 18629Domain d1bd0a2: 1bd0 A:12-244 [28642]
    Other proteins in same PDB: d1bd0a1, d1bd0b1

Details for d1bd0a2

PDB Entry: 1bd0 (more details), 1.6 Å

PDB Description: alanine racemase complexed with alanine phosphonate

SCOP Domain Sequences for d1bd0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd0a2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea

SCOP Domain Coordinates for d1bd0a2:

Click to download the PDB-style file with coordinates for d1bd0a2.
(The format of our PDB-style files is described here.)

Timeline for d1bd0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bd0a1