![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries) |
![]() | Domain d1h7wc2: 1h7w C:533-844 [28630] Other proteins in same PDB: d1h7wa1, d1h7wa3, d1h7wa4, d1h7wa5, d1h7wb1, d1h7wb3, d1h7wb4, d1h7wb5, d1h7wc1, d1h7wc3, d1h7wc4, d1h7wc5, d1h7wd1, d1h7wd3, d1h7wd4, d1h7wd5 complexed with fad, fmn, sf4 |
PDB Entry: 1h7w (more details), 1.9 Å
SCOPe Domain Sequences for d1h7wc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7wc2 c.1.4.1 (C:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
Timeline for d1h7wc2:
![]() Domains from same chain: (mouse over for more information) d1h7wc1, d1h7wc3, d1h7wc4, d1h7wc5 |