Lineage for d1h7wa2 (1h7w A:533-844)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091324Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2091549Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 2091550Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries)
  8. 2091555Domain d1h7wa2: 1h7w A:533-844 [28628]
    Other proteins in same PDB: d1h7wa1, d1h7wa3, d1h7wa4, d1h7wa5, d1h7wb1, d1h7wb3, d1h7wb4, d1h7wb5, d1h7wc1, d1h7wc3, d1h7wc4, d1h7wc5, d1h7wd1, d1h7wd3, d1h7wd4, d1h7wd5
    complexed with fad, fmn, sf4

Details for d1h7wa2

PDB Entry: 1h7w (more details), 1.9 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig
PDB Compounds: (A:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7wa2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOPe Domain Coordinates for d1h7wa2:

Click to download the PDB-style file with coordinates for d1h7wa2.
(The format of our PDB-style files is described here.)

Timeline for d1h7wa2: