Lineage for d1h7wa2 (1h7w A:533-844)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18552Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 18553Family c.1.4.1: FMN-linked oxidoreductases [51396] (6 proteins)
  6. 18567Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 18568Species Wild boar (Sus scrofa) [51411] (2 PDB entries)
  8. 18569Domain d1h7wa2: 1h7w A:533-844 [28628]
    Other proteins in same PDB: d1h7wa1, d1h7wa3, d1h7wa4, d1h7wa5, d1h7wb1, d1h7wb3, d1h7wb4, d1h7wb5, d1h7wc1, d1h7wc3, d1h7wc4, d1h7wc5, d1h7wd1, d1h7wd3, d1h7wd4, d1h7wd5

Details for d1h7wa2

PDB Entry: 1h7w (more details), 1.9 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig

SCOP Domain Sequences for d1h7wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7wa2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Wild boar (Sus scrofa)}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOP Domain Coordinates for d1h7wa2:

Click to download the PDB-style file with coordinates for d1h7wa2.
(The format of our PDB-style files is described here.)

Timeline for d1h7wa2: