Lineage for d1djqb1 (1djq B:1-340)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828289Protein Trimethylamine dehydrogenase, N-terminal domain [51406] (1 species)
    two other domains are alpha/beta Rossmann-like fold and beta/beta/alpha fold
  7. 2828290Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51407] (5 PDB entries)
  8. 2828296Domain d1djqb1: 1djq B:1-340 [28615]
    Other proteins in same PDB: d1djqa2, d1djqa3, d1djqb2, d1djqb3
    complexed with adp, fmn, sf4; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1djqb1

PDB Entry: 1djq (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant c30a mutant of trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)
PDB Compounds: (B:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1djqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djqb1 c.1.4.1 (B:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ardpkhdilfepiqigpktlrnrfyqvphaigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryd

SCOPe Domain Coordinates for d1djqb1:

Click to download the PDB-style file with coordinates for d1djqb1.
(The format of our PDB-style files is described here.)

Timeline for d1djqb1: