Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries) |
Domain d1dvja1: 1dvj A:9-228 [28546] Other proteins in same PDB: d1dvja2, d1dvjc2 complex with 6-azaUMP complexed with up6 |
PDB Entry: 1dvj (more details), 1.5 Å
SCOPe Domain Sequences for d1dvja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvja1 c.1.2.3 (A:9-228) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]} mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd pgetlrfadaiivgrsiyladnpaaaaagiiesikdllip
Timeline for d1dvja1:
View in 3D Domains from other chains: (mouse over for more information) d1dvjb_, d1dvjc1, d1dvjc2, d1dvjd_ |