Class b: All beta proteins [48724] (174 folds) |
Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns |
Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) |
Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein) |
Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species) delta subunit in mitochondria |
Species Escherichia coli [TaxId:562] [51347] (4 PDB entries) |
Domain d1bsna2: 1bsn A:1-86 [28436] Other proteins in same PDB: d1bsna1 |
PDB Entry: 1bsn (more details)
SCOPe Domain Sequences for d1bsna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsna2 b.93.1.1 (A:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]} amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee fiylsggilevqpgnvtvladtairg
Timeline for d1bsna2: