Lineage for d1dtoa1 (1dto A:1-201)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084248Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
    complex fold made of bifurcated and coiled beta-sheets
  4. 2084249Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families) (S)
    automatically mapped to Pfam PF00508
  5. 2084250Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein)
  6. 2084251Protein E2 regulatory, transactivation domain [51334] (3 species)
  7. 2084255Species Human papillomavirus type 16 [TaxId:333760] [51336] (2 PDB entries)
  8. 2084257Domain d1dtoa1: 1dto A:1-201 [28405]
    Other proteins in same PDB: d1dtoa2
    contains additional N-terminal (sub)domain; alpha-hairpin

Details for d1dtoa1

PDB Entry: 1dto (more details), 1.9 Å

PDB Description: crystal structure of the complete transactivation domain of e2 protein from the human papillomavirus type 16
PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1dtoa1:

Sequence, based on SEQRES records: (download)

>d1dtoa1 b.91.1.1 (A:1-201) E2 regulatory, transactivation domain {Human papillomavirus type 16 [TaxId: 333760]}
metlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvvp
tlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvevq
fdgdicntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekysk
nkvwevhaggqvilcptsvfs

Sequence, based on observed residues (ATOM records): (download)

>d1dtoa1 b.91.1.1 (A:1-201) E2 regulatory, transactivation domain {Human papillomavirus type 16 [TaxId: 333760]}
metlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvvp
tlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvevq
fdgdntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekysknk
vwevhaggqvilcptsvfs

SCOPe Domain Coordinates for d1dtoa1:

Click to download the PDB-style file with coordinates for d1dtoa1.
(The format of our PDB-style files is described here.)

Timeline for d1dtoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dtoa2