SCOPe 2.08: Domain d1ay9b_: 1ay9 B:

Lineage for d1ay9b_ (1ay9 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
   complex fold made of several coiled beta-sheets; contains an SH3-like barrel

4. Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families)

5. Family b.87.1.1: LexA-related [51307] (4 proteins)

6. Protein UmuD' [51308] (1 species)
   self-processed fragment of UmuD SOS response protein

7. Species Escherichia coli [TaxId:562] [51309] (3 PDB entries)

8. Domain d1ay9b_: 1ay9 B: [28385]

Details for d1ay9b_

PDB Entry: 1ay9, 3 Å

PDB Description: wild-type umud' from e. coli

PDB Compounds: (B:) umud protein

SCOPe Domain Sequences for d1ay9b_:

Sequence; same for both SEQRES and ATOM records:

>d1ay9b_ b.87.1.1 (B:) UmuD' {Escherichia coli [TaxId: 562]}
dyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgdiviaavd
geftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr

Timeline for d1ay9b_:

• d1ay9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ay9b_ appears in SCOPe 2.07