Lineage for d1f7pc_ (1f7p C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678502Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 678503Family b.85.4.1: dUTPase-like [51284] (4 proteins)
  6. 678534Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)
  7. 678547Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)
  8. 678561Domain d1f7pc_: 1f7p C: [28365]
    complexed with udp

Details for d1f7pc_

PDB Entry: 1f7p (more details), 2.3 Å

PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms.
PDB Compounds: (C:) Pol polyprotein

SCOP Domain Sequences for d1f7pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7pc_ b.85.4.1 (C:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgk

SCOP Domain Coordinates for d1f7pc_:

Click to download the PDB-style file with coordinates for d1f7pc_.
(The format of our PDB-style files is described here.)

Timeline for d1f7pc_: