SCOP 1.75: Domain d1duta_: 1dut A:

Lineage for d1duta_ (1dut A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)

8. Domain d1duta_: 1dut A: [28355]

Details for d1duta_

PDB Entry: 1dut, 1.9 Å

PDB Description: fiv dutp pyrophosphatase

PDB Compounds: (A:) dUTP pyrophosphatase

SCOP Domain Sequences for d1duta_:

Sequence; same for both SEQRES and ATOM records:

>d1duta_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkvv

Timeline for d1duta_:

• d1duta_ first appeared (with stable ids) in SCOP 1.55
  
• d1duta_ appears in SCOP 1.73
  
• d1duta_ appears in SCOPe 2.01
  
• d1duta_ appears in the current release, SCOPe 2.08