SCOP 1.55: Domain d1e2zc2: 1e2z C:169-232

Lineage for d1e2zc2 (1e2z C:169-232)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (3 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (5 PDB entries)

8. Domain d1e2zc2: 1e2z C:169-232 [28265]
   Other proteins in same PDB: d1e2za1, d1e2zb1, d1e2zc1

Details for d1e2zc2

PDB Entry: 1e2z, 2.5 Å

PDB Description: q158l mutant of cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1e2zc2:

Sequence; same for both SEQRES and ATOM records:

>d1e2zc2 b.84.2.2 (C:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1e2zc2:

• d1e2zc2 appears in SCOP 1.57
  
• d1e2zc2 appears in the current release, SCOPe 2.08