SCOP 1.55: Domain d1ewhc2: 1ewh C:169-232

Lineage for d1ewhc2 (1ewh C:169-232)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (3 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (5 PDB entries)

8. Domain d1ewhc2: 1ewh C:169-232 [28262]
   Other proteins in same PDB: d1ewha1, d1ewhb1, d1ewhc1

Details for d1ewhc2

PDB Entry: 1ewh, 2.35 Å

PDB Description: structure of cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1ewhc2:

Sequence; same for both SEQRES and ATOM records:

>d1ewhc2 b.84.2.2 (C:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1ewhc2:

• d1ewhc2 appears in SCOP 1.57
  
• d1ewhc2 appears in the current release, SCOPe 2.08