SCOP 1.75: Domain d1ewha2: 1ewh A:169-232

Lineage for d1ewha2 (1ewh A:169-232)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (6 PDB entries)

8. Domain d1ewha2: 1ewh A:169-232 [28260]
   Other proteins in same PDB: d1ewha1, d1ewhb1, d1ewhc1

Details for d1ewha2

PDB Entry: 1ewh, 2.35 Å

PDB Description: structure of cytochrome f from chlamydomonas reinhardtii

PDB Compounds: (A:) cytochrome f

SCOP Domain Sequences for d1ewha2:

Sequence; same for both SEQRES and ATOM records:

>d1ewha2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1ewha2:

• d1ewha2 first appeared (with stable ids) in SCOP 1.55
  
• d1ewha2 appears in SCOP 1.73
  
• d1ewha2 appears in SCOPe 2.01
  
• d1ewha2 appears in the current release, SCOPe 2.08