SCOPe 2.04: Domain d1cfmc2: 1cfm C:169-232

Lineage for d1cfmc2 (1cfm C:169-232)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries)

8. Domain d1cfmc2: 1cfm C:169-232 [28259]
   Other proteins in same PDB: d1cfma1, d1cfmb1, d1cfmc1
   complexed with hem

Details for d1cfmc2

PDB Entry: 1cfm, 2 Å

PDB Description: cytochrome f from chlamydomonas reinhardtii

PDB Compounds: (C:) cytochrome f

SCOPe Domain Sequences for d1cfmc2:

Sequence; same for both SEQRES and ATOM records:

>d1cfmc2 b.84.2.2 (C:169-232) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1cfmc2:

• d1cfmc2 first appeared (with stable ids) in SCOP 1.55
  
• d1cfmc2 appears in SCOPe 2.03
  
• d1cfmc2 appears in SCOPe 2.05
  
• d1cfmc2 appears in the current release, SCOPe 2.08