Lineage for d1cfmb2 (1cfm B:169-232)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560230Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1560326Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 1560327Protein Cytochrome f, small domain [51257] (5 species)
  7. 1560328Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries)
  8. 1560335Domain d1cfmb2: 1cfm B:169-232 [28258]
    Other proteins in same PDB: d1cfma1, d1cfmb1, d1cfmc1
    complexed with hem

Details for d1cfmb2

PDB Entry: 1cfm (more details), 2 Å

PDB Description: cytochrome f from chlamydomonas reinhardtii
PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d1cfmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfmb2 b.84.2.2 (B:169-232) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

SCOPe Domain Coordinates for d1cfmb2:

Click to download the PDB-style file with coordinates for d1cfmb2.
(The format of our PDB-style files is described here.)

Timeline for d1cfmb2: