SCOP 1.67: Domain d1cfma2: 1cfm A:169-232

Lineage for d1cfma2 (1cfm A:169-232)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (4 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (6 PDB entries)

8. Domain d1cfma2: 1cfm A:169-232 [28257]
   Other proteins in same PDB: d1cfma1, d1cfmb1, d1cfmc1

Details for d1cfma2

PDB Entry: 1cfm, 2 Å

PDB Description: cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1cfma2:

Sequence; same for both SEQRES and ATOM records:

>d1cfma2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1cfma2:

• d1cfma2 first appeared (with stable ids) in SCOP 1.55
  
• d1cfma2 appears in SCOP 1.65
  
• d1cfma2 appears in SCOP 1.69
  
• d1cfma2 appears in the current release, SCOPe 2.08