Class b: All beta proteins [48724] (144 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) |
Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein) |
Protein Cytochrome f, small domain [51257] (4 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (6 PDB entries) |
Domain d1e2wb2: 1e2w B:169-232 [28253] Other proteins in same PDB: d1e2wa1, d1e2wb1 |
PDB Entry: 1e2w (more details), 1.6 Å
SCOP Domain Sequences for d1e2wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2wb2 b.84.2.2 (B:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii} tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl tnnp
Timeline for d1e2wb2: