SCOP 1.55: Domain d1e2wb2: 1e2w B:169-232

Lineage for d1e2wb2 (1e2w B:169-232)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (3 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (5 PDB entries)

8. Domain d1e2wb2: 1e2w B:169-232 [28253]
   Other proteins in same PDB: d1e2wa1, d1e2wb1

Details for d1e2wb2

PDB Entry: 1e2w, 1.6 Å

PDB Description: n168f mutant of cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1e2wb2:

Sequence; same for both SEQRES and ATOM records:

>d1e2wb2 b.84.2.2 (B:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1e2wb2:

• d1e2wb2 appears in SCOP 1.57
  
• d1e2wb2 appears in the current release, SCOPe 2.08