Lineage for d1ctma2 (1ctm A:168-230)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810849Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 810910Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 810911Protein Cytochrome f, small domain [51257] (5 species)
  7. 810935Species Turnip (Brassica rapa) [TaxId:3711] [51258] (2 PDB entries)
  8. 810937Domain d1ctma2: 1ctm A:168-230 [28251]
    Other proteins in same PDB: d1ctma1
    complexed with hem

Details for d1ctma2

PDB Entry: 1ctm (more details), 2.3 Å

PDB Description: crystal structure of chloroplast cytochrome f reveals a novel cytochrome fold and unexpected heme ligation
PDB Compounds: (A:) cytochrome f

SCOP Domain Sequences for d1ctma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctma2 b.84.2.2 (A:168-230) Cytochrome f, small domain {Turnip (Brassica rapa) [TaxId: 3711]}
ntvynataggiiskilrkekggyeitivdasnerqvidiiprglellvsegesikldqpl
tsn

SCOP Domain Coordinates for d1ctma2:

Click to download the PDB-style file with coordinates for d1ctma2.
(The format of our PDB-style files is described here.)

Timeline for d1ctma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ctma1