SCOP 1.55: Domain d1qiuf2: 1qiu F:319-395

Lineage for d1qiuf2 (1qiu F:319-395)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.83: Triple beta-spiral [51224] (1 superfamily)

4. Superfamily b.83.1: Adenovirus fibre shaft [51225] (1 family)

5. Family b.83.1.1: Adenovirus fibre shaft [51226] (1 protein)

6. Protein Adenovirus fibre shaft [51227] (1 species)

7. Species Human adenovirus type 2 [TaxId:10515] [51228] (1 PDB entry)

8. Domain d1qiuf2: 1qiu F:319-395 [28213]
   Other proteins in same PDB: d1qiua1, d1qiub1, d1qiuc1, d1qiud1, d1qiue1, d1qiuf1

Details for d1qiuf2

PDB Entry: 1qiu, 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres

SCOP Domain Sequences for d1qiuf2:

Sequence; same for both SEQRES and ATOM records:

>d1qiuf2 b.83.1.1 (F:319-395) Adenovirus fibre shaft {Human adenovirus type 2}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitignkn

Timeline for d1qiuf2:

• d1qiuf2 appears in SCOP 1.57
  
• d1qiuf2 appears in the current release, SCOPe 2.08