Lineage for d1bera2 (1ber A:9-137)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63617Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 63715Superfamily b.82.3: cAMP-binding domain-like [51206] (2 families) (S)
  5. 63721Family b.82.3.2: cAMP-binding domain [51210] (2 proteins)
  6. 63722Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 63723Species Escherichia coli [TaxId:562] [51212] (7 PDB entries)
  8. 63729Domain d1bera2: 1ber A:9-137 [28133]
    Other proteins in same PDB: d1bera1, d1berb1

Details for d1bera2

PDB Entry: 1ber (more details), 2.5 Å

PDB Description: structure of the cap-dna complex at 2.5 angstroms resolution: a complete picture of the protein-dna interface

SCOP Domain Sequences for d1bera2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bera2 b.82.3.2 (A:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

SCOP Domain Coordinates for d1bera2:

Click to download the PDB-style file with coordinates for d1bera2.
(The format of our PDB-style files is described here.)

Timeline for d1bera2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bera1