SCOP 1.67: Domain d1caxf_: 1cax F:

Lineage for d1caxf_ (1cax F:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (12 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (5 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)

8. Domain d1caxf_: 1cax F: [28109]

Details for d1caxf_

PDB Entry: 1cax, 2.6 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement

SCOP Domain Sequences for d1caxf_:

Sequence; same for both SEQRES and ATOM records:

>d1caxf_ b.82.1.2 (F:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
gqpr

Timeline for d1caxf_:

• d1caxf_ first appeared (with stable ids) in SCOP 1.55
  
• d1caxf_ appears in SCOP 1.65
  
• d1caxf_ appears in SCOP 1.69
  
• d1caxf_ appears in the current release, SCOPe 2.08