Lineage for d1caxe_ (1cax E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies) 
Superfamily b.82.1: RmlC-like [51182] (4 families) 
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (1 protein) Protein Seed storage 7S protein [51188] (2 species) Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries) 
Domain d1caxe_: 1cax E: [28108]
Details for d1caxe_
PDB Entry: 1cax (more details), 2.6 Å
PDB Description: determination of three crystal structures of canavalin by molecular replacement
SCOP Domain Sequences for d1caxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1caxe_ b.82.1.2 (E:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
k
SCOP Domain Coordinates for d1caxe_:
Click to download the PDB-style file with coordinates for d1caxe_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1caxe_:
- d1caxe_ appears in SCOP 1.57
- d1caxe_ appears in the current release, SCOPe 2.08
View in 3D
