Lineage for d1caub_ (1cau B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567257Superfamily b.82.1: RmlC-like cupins [51182] (16 families) (S)
  5. 567289Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 567308Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 567343Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 567357Domain d1caub_: 1cau B: [28103]

Details for d1caub_

PDB Entry: 1cau (more details), 2.3 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement

SCOP Domain Sequences for d1caub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1caub_ b.82.1.2 (B:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
gqpr

SCOP Domain Coordinates for d1caub_:

Click to download the PDB-style file with coordinates for d1caub_.
(The format of our PDB-style files is described here.)

Timeline for d1caub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1caua_