Lineage for d1dgrb_ (1dgr B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677316Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 677339Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 677349Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 677360Domain d1dgrb_: 1dgr B: [28098]

Details for d1dgrb_

PDB Entry: 1dgr (more details), 2.6 Å

PDB Description: Refined crystal structure of canavalin from jack bean
PDB Compounds: (B:) canavalin

SCOP Domain Sequences for d1dgrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgrb_ b.82.1.2 (B:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp

SCOP Domain Coordinates for d1dgrb_:

Click to download the PDB-style file with coordinates for d1dgrb_.
(The format of our PDB-style files is described here.)

Timeline for d1dgrb_: