Lineage for d1dgr.1 (1dgr X:,Y:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17822Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 17833Family b.82.1.2: Germin/Seed storage 7S protein [51187] (1 protein)
  6. 17834Protein Seed storage 7S protein [51188] (2 species)
  7. 17844Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. Domain d1dgr.1: 1dgr X:,Y: [28097]

Details for d1dgr.1

PDB Entry: 1dgr (more details), 2.6 Å

PDB Description: Refined crystal structure of canavalin from jack bean
PDB Compounds: (X:) , (Y:)

SCOP Domain Sequences for d1dgr.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dgr.1 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvglXmqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenn
ernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqp

SCOP Domain Coordinates for d1dgr.1 are not available.

Timeline for d1dgr.1:

Domains from other chains:
(mouse over for more information)
d1dgr.2, d1dgr.2, d1dgr.2, d1dgr.2, d1dgr.3, d1dgr.3, d1dgr.3, d1dgr.3, d1dgra_, d1dgra_, d1dgrb_, d1dgrb_, d1dgrc_, d1dgrc_