Lineage for d2cava2 (2cav A:246-422)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17822Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 17833Family b.82.1.2: Germin/Seed storage 7S protein [51187] (1 protein)
  6. 17834Protein Seed storage 7S protein [51188] (2 species)
  7. 17844Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 17850Domain d2cava2: 2cav A:246-422 [28095]

Details for d2cava2

PDB Entry: 2cav (more details), 2 Å

PDB Description: canavalin from jack bean
PDB Compounds: (A:)

SCOP Domain Sequences for d2cava2:

Sequence, based on SEQRES records: (download)

>d2cava2 b.82.1.2 (A:246-422) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaasdlnmv
gigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgq

Sequence, based on observed residues (ATOM records): (download)

>d2cava2 b.82.1.2 (A:246-422) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvglqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenner
nflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgq

SCOP Domain Coordinates for d2cava2:

Click to download the PDB-style file with coordinates for d2cava2.
(The format of our PDB-style files is described here.)

Timeline for d2cava2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cava1