Lineage for d2cava1 (2cav A:46-225)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 962885Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 962963Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. 962986Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 962996Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 963001Domain d2cava1: 2cav A:46-225 [28094]

Details for d2cava1

PDB Entry: 2cav (more details), 2 Å

PDB Description: canavalin from jack bean
PDB Compounds: (A:) protein (canavalin)

SCOPe Domain Sequences for d2cava1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cava1 b.82.1.2 (A:46-225) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkd

SCOPe Domain Coordinates for d2cava1:

Click to download the PDB-style file with coordinates for d2cava1.
(The format of our PDB-style files is described here.)

Timeline for d2cava1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cava2