Lineage for d1dgw.1 (1dgw X:,Y:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138045Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1138123Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. 1138147Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 1138157Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 1138158Domain d1dgw.1: 1dgw X:,Y: [28091]
    complexed with po4

Details for d1dgw.1

PDB Entry: 1dgw (more details), 1.7 Å

PDB Description: Structure of the rhombohedral crystal of canavalin from jack bean
PDB Compounds: (X:) canavalin, (Y:) canavalin

SCOPe Domain Sequences for d1dgw.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dgw.1 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvgleXqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenn
ernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqp

SCOPe Domain Coordinates for d1dgw.1:

Click to download the PDB-style file with coordinates for d1dgw.1.
(The format of our PDB-style files is described here.)

Timeline for d1dgw.1: