SCOP 1.57: Domain d1phs_2: 1phs 220-381

Lineage for d1phs_2 (1phs 220-381)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.1: RmlC-like [51182] (4 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (2 proteins)

6. Protein Seed storage 7S protein [51188] (2 species)

7. Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)

8. Domain d1phs_2: 1phs 220-381 [28089]

Details for d1phs_2

PDB Entry: 1phs, 3 Å

PDB Description: the three-dimensional structure of the seed storage protein phaseolin at 3 angstroms resolution

SCOP Domain Sequences for d1phs_2:

Sequence; same for both SEQRES and ATOM records:

>d1phs_2 b.82.1.2 (220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin}
ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk
gnketleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdn
vissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah

Timeline for d1phs_2:

• d1phs_2 first appeared (with stable ids) in SCOP 1.55
  
• d1phs_2 appears in SCOP 1.59
  
• d1phs_2 appears in the current release, SCOPe 2.08, called d1phsa2