Lineage for d1phs_2 (1phs 220-381)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17822Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 17833Family b.82.1.2: Germin/Seed storage 7S protein [51187] (1 protein)
  6. 17834Protein Seed storage 7S protein [51188] (2 species)
  7. 17835Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)
  8. 17843Domain d1phs_2: 1phs 220-381 [28089]

Details for d1phs_2

PDB Entry: 1phs (more details), 3 Å

PDB Description: the three-dimensional structure of the seed storage protein phaseolin at 3 angstroms resolution

SCOP Domain Sequences for d1phs_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phs_2 b.82.1.2 (220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin}
ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk
gnketleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdn
vissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah

SCOP Domain Coordinates for d1phs_2:

Click to download the PDB-style file with coordinates for d1phs_2.
(The format of our PDB-style files is described here.)

Timeline for d1phs_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1phs_1