Lineage for d1phs_1 (1phs 11-212)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470566Superfamily b.82.1: RmlC-like cupins [51182] (13 families) (S)
  5. 470598Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 470617Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 470643Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)
  8. 470650Domain d1phs_1: 1phs 11-212 [28088]

Details for d1phs_1

PDB Entry: 1phs (more details), 3 Å

PDB Description: the three-dimensional structure of the seed storage protein phaseolin at 3 angstroms resolution

SCOP Domain Sequences for d1phs_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phs_1 b.82.1.2 (11-212) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin}
dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
vivnidseqikelskhaksssr

SCOP Domain Coordinates for d1phs_1:

Click to download the PDB-style file with coordinates for d1phs_1.
(The format of our PDB-style files is described here.)

Timeline for d1phs_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1phs_2