SCOPe 2.08: Domain d1phsa1: 1phs A:11-212

Lineage for d1phsa1 (1phs A:11-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)

8. Domain d1phsa1: 1phs A:11-212 [28088]
   CA-atoms only

Details for d1phsa1

PDB Entry: 1phs, 3 Å

PDB Description: the three-dimensional structure of the seed storage protein phaseolin at 3 angstroms resolution

PDB Compounds: (A:) phaseolin, beta-type precursor

SCOPe Domain Sequences for d1phsa1:

Sequence; same for both SEQRES and ATOM records:

>d1phsa1 b.82.1.2 (A:11-212) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}
dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
vivnidseqikelskhaksssr

Timeline for d1phsa1:

• d1phsa1 first appeared (with stable ids) in SCOP 1.55, called d1phs_1
  
• d1phsa1 appears in SCOPe 2.07