SCOPe 2.08: Domain d2phlc1: 2phl C:10-210

Lineage for d2phlc1 (2phl C:10-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)

8. Domain d2phlc1: 2phl C:10-210 [28086]
   complexed with nag, po4

Details for d2phlc1

PDB Entry: 2phl, 2.2 Å

PDB Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins

PDB Compounds: (C:) phaseolin

SCOPe Domain Sequences for d2phlc1:

Sequence; same for both SEQRES and ATOM records:

>d2phlc1 b.82.1.2 (C:10-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]}
qdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqq
adaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedl
riiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqe
gvivnidseqikelskhakss

Timeline for d2phlc1:

• d2phlc1 first appeared (with stable ids) in SCOP 1.55
  
• d2phlc1 appears in SCOPe 2.07