Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (24 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries) |
Domain d2phlb1: 2phl B:11-210 [28084] |
PDB Entry: 2phl (more details), 2.2 Å
SCOP Domain Sequences for d2phlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2phlb1 b.82.1.2 (B:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg vivnidseqikelskhakss
Timeline for d2phlb1:
View in 3D Domains from other chains: (mouse over for more information) d2phla1, d2phla2, d2phlc1, d2phlc2 |