Lineage for d4zqia2 (4zqi A:97-306)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928777Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1928778Protein automated matches [226904] (27 species)
    not a true protein
  7. 1928902Species Yersinia pestis [TaxId:632] [280584] (1 PDB entry)
  8. 1928903Domain d4zqia2: 4zqi A:97-306 [280592]
    Other proteins in same PDB: d4zqia1, d4zqib1, d4zqic1, d4zqid1
    automated match to d1iova2
    complexed with na

Details for d4zqia2

PDB Entry: 4zqi (more details), 2.3 Å

PDB Description: crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4zqia2:

Sequence, based on SEQRES records: (download)

>d4zqia2 d.142.1.0 (A:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky
lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg
mtshslvpmaarqyglsfsqlvarilmlad

Sequence, based on observed residues (ATOM records): (download)

>d4zqia2 d.142.1.0 (A:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshsvgmskvdh
aselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvktqyfcpsgls
deseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqy
glsfsqlvarilmlad

SCOPe Domain Coordinates for d4zqia2:

Click to download the PDB-style file with coordinates for d4zqia2.
(The format of our PDB-style files is described here.)

Timeline for d4zqia2: