Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.4: Complement components [48251] (4 proteins) probably related to other families, but has no known enzymatic activity |
Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48253] (17 PDB entries) |
Domain d4zh1c_: 4zh1 C: [280574] Other proteins in same PDB: d4zh1a2 automated match to d1ghqa_ complexed with bgc, gal, gol, nga, sia |
PDB Entry: 4zh1 (more details), 2.24 Å
SCOPe Domain Sequences for d4zh1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zh1c_ a.102.4.4 (C:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]} aerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytqq lafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpdg vfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdfl eanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsya llallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
Timeline for d4zh1c_: