SCOPe 2.05: Domain d4ylqt1: 4ylq T:1-106

Lineage for d4ylqt1 (4ylq T:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
   Uniprot P13726 33-242

8. Domain d4ylqt1: 4ylq T:1-106 [280547]
   Other proteins in same PDB: d4ylql1, d4ylql2, d4ylql3
   automated match to d1boya1
   complexed with 0z7, bgc, ca, fuc, pol, tma, xys

Details for d4ylqt1

PDB Entry: 4ylq, 1.4 Å

PDB Description: crystal structure of a fviia-trypsin chimera (ft) in complex with soluble tissue factor

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d4ylqt1:

Sequence; same for both SEQRES and ATOM records:

>d4ylqt1 b.1.2.1 (T:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d4ylqt1:

• d4ylqt1 is new in SCOPe 2.05-stable
  
• d4ylqt1 appears in SCOPe 2.06
  
• d4ylqt1 appears in the current release, SCOPe 2.08