Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (30 species) not a true protein |
Species Streptococcus mutans [TaxId:1309] [280539] (1 PDB entry) |
Domain d4yipb2: 4yip B:90-203 [280546] Other proteins in same PDB: d4yipa1, d4yipb1, d4yipc1, d4yipd1 automated match to d3h1sb2 complexed with fe |
PDB Entry: 4yip (more details), 2.15 Å
SCOPe Domain Sequences for d4yipb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yipb2 d.44.1.0 (B:90-203) automated matches {Streptococcus mutans [TaxId: 1309]} ektkvtaevaaaineafgsfddfkaaftaaattrfgsgwawlvvdkegklevtstanqdt pisqglkpilaldvwehayylnyrnvrpnyikaffevinwntvarlyaealtle
Timeline for d4yipb2: