Lineage for d4yipc2 (4yip C:90-201)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1903998Species Streptococcus mutans [TaxId:1309] [280539] (1 PDB entry)
  8. 1904001Domain d4yipc2: 4yip C:90-201 [280544]
    Other proteins in same PDB: d4yipa1, d4yipb1, d4yipc1, d4yipd1
    automated match to d3h1sb2
    complexed with fe

Details for d4yipc2

PDB Entry: 4yip (more details), 2.15 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus mutans
PDB Compounds: (C:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d4yipc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yipc2 d.44.1.0 (C:90-201) automated matches {Streptococcus mutans [TaxId: 1309]}
ektkvtaevaaaineafgsfddfkaaftaaattrfgsgwawlvvdkegklevtstanqdt
pisqglkpilaldvwehayylnyrnvrpnyikaffevinwntvarlyaealt

SCOPe Domain Coordinates for d4yipc2:

Click to download the PDB-style file with coordinates for d4yipc2.
(The format of our PDB-style files is described here.)

Timeline for d4yipc2: