SCOPe 2.05: Domain d4ylql3: 4ylq L:87-143

Lineage for d4ylql3 (4ylq L:87-143)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d4ylql3: 4ylq L:87-143 [280533]
   Other proteins in same PDB: d4ylql1, d4ylqt1, d4ylqt2
   automated match to d1danl2
   complexed with 0z7, bgc, ca, fuc, pol, tma, xys

Details for d4ylql3

PDB Entry: 4ylq, 1.4 Å

PDB Description: crystal structure of a fviia-trypsin chimera (ft) in complex with soluble tissue factor

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d4ylql3:

Sequence; same for both SEQRES and ATOM records:

>d4ylql3 g.3.11.1 (L:87-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

Timeline for d4ylql3:

• d4ylql3 is new in SCOPe 2.05-stable
  
• d4ylql3 appears in SCOPe 2.06
  
• d4ylql3 appears in the current release, SCOPe 2.08