Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Streptococcus thermophilus [TaxId:1308] [280529] (1 PDB entry) |
Domain d4yioa2: 4yio A:90-199 [280530] Other proteins in same PDB: d4yioa1, d4yioa3, d4yiob1, d4yiob3 automated match to d2awpa2 complexed with fe, gol, so4 |
PDB Entry: 4yio (more details), 1.6 Å
SCOPe Domain Sequences for d4yioa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yioa2 d.44.1.0 (A:90-199) automated matches {Streptococcus thermophilus [TaxId: 1308]} ekqeptaevaaaineafgsfeafqevfttsattrfgsgwawlvvnaegklevvstpnqdt pisdgkkpilaldvwehayylkyrnvrpnyikaffeiinwnkvaelyaea
Timeline for d4yioa2: