SCOPe 2.08: Domain d4yioa2: 4yio A:90-199

Lineage for d4yioa2 (4yio A:90-199)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Streptococcus thermophilus [TaxId:1308] [280529] (1 PDB entry)

8. Domain d4yioa2: 4yio A:90-199 [280530]
   Other proteins in same PDB: d4yioa1, d4yioa3, d4yiob1, d4yiob3
   automated match to d2awpa2
   complexed with fe, gol, so4

Details for d4yioa2

PDB Entry: 4yio, 1.6 Å

PDB Description: x-ray structure of the iron/manganese cambialistic superoxide dismutase from streptococcus thermophilus

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4yioa2:

Sequence; same for both SEQRES and ATOM records:

>d4yioa2 d.44.1.0 (A:90-199) automated matches {Streptococcus thermophilus [TaxId: 1308]}
ekqeptaevaaaineafgsfeafqevfttsattrfgsgwawlvvnaegklevvstpnqdt
pisdgkkpilaldvwehayylkyrnvrpnyikaffeiinwnkvaelyaea

Timeline for d4yioa2:

• d4yioa2 first appeared in SCOPe 2.05
  
• d4yioa2 appears in SCOPe 2.07