Lineage for d4xxkb_ (4xxk B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979527Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1979528Protein automated matches [190590] (21 species)
    not a true protein
  7. 1979624Species Nostoc sp. [TaxId:103690] [280510] (2 PDB entries)
  8. 1979628Domain d4xxkb_: 4xxk B: [280514]
    Other proteins in same PDB: d4xxka2
    automated match to d4po5a_
    complexed with cyc

Details for d4xxkb_

PDB Entry: 4xxk (more details), 2.97 Å

PDB Description: crystal structure of the semet-derivative of the bilin-binding domain of phycobilisome core-membrane linker apce
PDB Compounds: (B:) Phycobiliprotein ApcE

SCOPe Domain Sequences for d4xxkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xxkb_ a.1.1.0 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
lavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqki
enmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaas
lsyfrkdpeaaeivsqymdvlitefka

SCOPe Domain Coordinates for d4xxkb_:

Click to download the PDB-style file with coordinates for d4xxkb_.
(The format of our PDB-style files is described here.)

Timeline for d4xxkb_: