Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Nostoc sp. [TaxId:103690] [280510] (2 PDB entries) |
Domain d4xxkb_: 4xxk B: [280514] Other proteins in same PDB: d4xxka2 automated match to d4po5a_ complexed with cyc |
PDB Entry: 4xxk (more details), 2.97 Å
SCOPe Domain Sequences for d4xxkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xxkb_ a.1.1.0 (B:) automated matches {Nostoc sp. [TaxId: 103690]} lavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqki enmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaas lsyfrkdpeaaeivsqymdvlitefka
Timeline for d4xxkb_: