SCOPe 2.08: Domain d4xxia_: 4xxi A:

Lineage for d4xxia_ (4xxi A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [280510] (2 PDB entries)

8. Domain d4xxia_: 4xxi A: [280513]
   automated match to d4po5a_
   complexed with cyc

Details for d4xxia_

PDB Entry: 4xxi, 2.2 Å

PDB Description: crystal structure of the bilin-binding domain of phycobilisome core- membrane linker apce

PDB Compounds: (A:) Phycobiliprotein ApcE

SCOPe Domain Sequences for d4xxia_:

Sequence; same for both SEQRES and ATOM records:

>d4xxia_ a.1.1.0 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
lavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqki
enmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaas
lsyfrkdpeaaeivsqymdvlitefka

Timeline for d4xxia_:

• d4xxia_ first appeared in SCOPe 2.05
  
• d4xxia_ appears in SCOPe 2.07