Class b: All beta proteins [48724] (178 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.2: Insect cysteine-rich antifreeze protein [51156] (1 family) superhelix turns are made of two short strands each |
Family b.80.2.1: Insect cysteine-rich antifreeze protein [51157] (1 protein) this is a repeat family; one repeat unit is 1ezg A:35-47 found in domain |
Protein Insect cysteine-rich antifreeze protein [51158] (1 species) |
Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [51159] (2 PDB entries) |
Domain d1ezga_: 1ezg A: [28050] |
PDB Entry: 1ezg (more details), 1.4 Å
SCOPe Domain Sequences for d1ezga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezga_ b.80.2.1 (A:) Insect cysteine-rich antifreeze protein {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]} qctggadctsctgactgcgncpnavtctnsqhcvkantctgstdcntaqtctnskdcfea ntctdstncykatactnssgcp
Timeline for d1ezga_: