SCOPe 2.08: Domain d4xfpc2: 4xfp C:159-310

Lineage for d4xfpc2 (4xfp C:159-310)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein automated matches [254656] (4 species)
   not a true protein

7. Species Bacillus tb-90 [TaxId:36824] [280497] (1 PDB entry)

8. Domain d4xfpc2: 4xfp C:159-310 [280499]
   automated match to d1j2ga2
   complexed with aza, cl, so4; mutant

Details for d4xfpc2

PDB Entry: 4xfp, 1.66 Å

PDB Description: crystal structure of highly active mutant of bacillus sp. tb-90 urate oxidase

PDB Compounds: (C:) urate oxidase

SCOPe Domain Sequences for d4xfpc2:

Sequence, based on SEQRES records:

>d4xfpc2 d.96.1.4 (C:159-310) automated matches {Bacillus tb-90 [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeigesegkvyteprppygfqcftvtq

Sequence, based on observed residues (ATOM records):

>d4xfpc2 d.96.1.4 (C:159-310) automated matches {Bacillus tb-90 [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkikvyteprppygfqcftvtq

Timeline for d4xfpc2:

• d4xfpc2 first appeared in SCOPe 2.05
  
• d4xfpc2 appears in SCOPe 2.07